SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150GJC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150GJC5
Domain Number 1 Region: 101-205,329-386
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000746
Family Ankyrin repeat 0.0088
Further Details:      
 
Domain Number 2 Region: 371-450
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000196
Family Pseudo ankyrin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150GJC5
Sequence length 550
Comment (tr|A0A150GJC5|A0A150GJC5_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ49864.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_19g315 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MATGQADSEAEGEEAPSVHGTGDASRVWLPELVQRVAAFLPANVVACTLRLVDKATAALF
KGPEHTVVLLSQPVPEAAFAQRWGRPEKLRALTLSQRQKLLRLTARSGSLHNLQTLVAMP
DYFPPLCKDVFSAAASAGHLHACEWLLERSCPWGGEVLSAAARAGHQHVCSWLLAKGCPW
SDTAPAQAAHGGHLALAEWLAQQRPGEVDAHALLVGAAEGCELPTLQRLHSQWLEARGQR
LHSWHEGPVLDAAAGSPTADWRAKVEWLQGRGYDWEAYSLRCLLPRADWRERAAWLLERG
FPLGGLQGLARIAAGAGDTDALGYLFSLGVQLSEEHAQEALCAAVRHGHLPAARAVCPPA
HRVNGQLLAAVAARNGQLRVLEWLLELLGPVLVLTRDTFRWAAGSGSVDLLAWLRDRDCP
WSARAFEQAVQAGSEDQMQWLLERGCPTGADGEPYLAASSNDDVAALCCLQRLGCACPRD
TFMRAVRRMAASSGPPPSRRALRWLLQQGCDAEWPQAEVAAQLSVSQRELHGIIKELRDW
HVGGADPPVG
Download sequence
Identical sequences A0A150GJC5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]