SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150GPT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150GPT4
Domain Number 1 Region: 338-483
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000121
Family Ankyrin repeat 0.0079
Further Details:      
 
Domain Number 2 Region: 121-200
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000248
Family Pseudo ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150GPT4
Sequence length 505
Comment (tr|A0A150GPT4|A0A150GPT4_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ51847.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_11g286 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MQPHLGYDNGGTCTLGSLLWFPDLAERIAAHLPPNEVPCGMRLVNKATAALFSKEEHKIV
DTCKPVPLGAFAERWGRGRARELTLDGRRDLIRCTALSGDLPNLELATDACGLLPPLDCW
LAAAQNGHIHICDWLKKRDRPFDKQRGAVALAARHGHRQTCDWLLREAGYPWSEEAVCEG
LRRGDLDLANWLLQQRPAEPEAENDNNEHGGGRPELLGGVLAAAAHGFDLSTFRRLLWEL
LPDATPASEPSDGGNQATVPAALRALALRVGDEPLSEEDLGSVVAGAAGSKTSDWAAKME
WLEAEGYPKTPEATEKAAACKNSALQRLQWLRGRGYPLGEGAIKEAVSRGDMPALQYLLA
EGAPSDVEAADLAARNGRLAALQVLHTTGRLVTAEGAAMHAAWGGHLPVLAWLVEESGLG
VELHYDIFAQATQSGNVGMLEWLHQRGCPTEPDGKKHWSAVDYAVAGGHEPSIEWLVERG
CSIPVGAAVKGHAQGPVAGRGYLAG
Download sequence
Identical sequences A0A150GPT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]