SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150JD10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150JD10
Domain Number 1 Region: 97-184
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 6.91e-31
Family TATA-box binding protein (TBP), C-terminal domain 0.0000511
Further Details:      
 
Domain Number 2 Region: 7-95
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 3.61e-28
Family TATA-box binding protein (TBP), C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150JD10
Sequence length 186
Comment (tr|A0A150JD10|A0A150JD10_9EURY) TATA-box factor {ECO:0000256|HAMAP-Rule:MF_00408} KW=Complete proteome OX=1706433 OS=Arc I group archaeon ADurb1013_Bin02101. GN=AN188_00344 OC=Arc I group.
Sequence
MSESKLGKYKMTVQNVVTSANLFNRVDLVKAASSLDNIEYEPEQFPGMVIRLDEPKTATL
VFGSGKLVCTGAKSPEESRKAIFKIIEILKDYGTPMEKEPDIVVQNIVASGDLEMKLNLD
DIILTLPNCEYEPEQFPGLIYRLKEPKVVLLLFGSGKVVCTGAKSEEDVIRAIERVKKSL
IDEGLV
Download sequence
Identical sequences A0A150JD10 A0A150JJN9 A0A150JLZ4 A0A1V6IMF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]