SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150JHW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150JHW8
Domain Number 1 Region: 18-150
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 7.19e-45
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0000676
Further Details:      
 
Domain Number 2 Region: 152-281
Classification Level Classification E-value
Superfamily Translational machinery components 1.05e-36
Family ERF1/Dom34 middle domain-like 0.00072
Further Details:      
 
Domain Number 3 Region: 283-427
Classification Level Classification E-value
Superfamily L30e-like 4.88e-33
Family ERF1/Dom34 C-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150JHW8
Sequence length 428
Comment (tr|A0A150JHW8|A0A150JHW8_9EURY) Translation termination factor aRF1 {ECO:0000256|HAMAP-Rule:MF_00424} KW=Complete proteome OX=1706434 OS=Arc I group archaeon ADurb1113_Bin01801. GN=APG08_00596 OC=Arc I group.
Sequence
MEDVGTLLNIFYVLMIMDNKEFYEFKKQLKFLSKIRGRHTELVSVYIPAGYEISKVAAQI
KDEQGTATNIKSKNTRKNVLSALERVMQHLRLYKMTPPNGLIIFSGNISEDEGNPKIELF
TLNPPEPISVRIYRCDQQFVLDPLLEMIEDKRVFGLIIVERGEASIGLLRGKKVELLKHL
TSRVPGKFRAGGQSSVRFARLREIAADDFKDTVGETANEIFLAQQNLEGILIGGGGYTKY
EFEEGEYLHHELRKKILGIADTTYTELFGLNELVDKSAGILENLDITKEKDVVTKFLKEL
IKDDSFAAYGEKEVRKYLDAGAVDLLLLSEGLNKNRIKIKCTSCGNLTEKTSTDEELFQL
EQQISGVPCEKCSNLSLNIEEKIDLLEELADLAQEGSTQVEVISTETEEGNQLLKAFGGI
AAIVRYRL
Download sequence
Identical sequences A0A150JAF0 A0A150JHW8 A0A150JPE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]