SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150M991 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150M991
Domain Number 1 Region: 29-148
Classification Level Classification E-value
Superfamily TM1646-like 1.7e-36
Family TM1646-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A150M991
Sequence length 148
Comment (tr|A0A150M991|A0A150M991_GEOSE) UDP-N-acetylenolpyruvoylglucosamine reductase {ECO:0000313|EMBL:KYD20749.1} KW=Complete proteome OX=1422 OS=Geobacillus stearothermophilus (Bacillus stearothermophilus). GN=B4109_2673 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MMAMEVQKVTRTGLANVGRKNDAPMESVSFTEVMAKTRRDVVWERINEQVRQIEEQGKKL
AESRTVEDLRKYKQLVKSFLDDAVKNGLQLEEQRGFSRGGRARIYKLVKEVDQKLVELTN
EVLKKEQKGLEILRLVGEIQGLIINIYT
Download sequence
Identical sequences A0A150M991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]