SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150QP65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150QP65
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.25e-22
Family PA0094-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A150QP65
Sequence length 147
Comment (tr|A0A150QP65|A0A150QP65_SORCE) Uncharacterized protein {ECO:0000313|EMBL:KYF69773.1} KW=Complete proteome OX=56 OS=Sorangium cellulosum (Polyangium cellulosum). GN=BE15_10155 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MPRYESSEVSFDVPRDWEDRSVVAFAAPSEPGEVAAASVVMTRDRLAAGEDLRRYADRQL
LELAKRLEGFQLLARHDRPAGDRPGLELRFAWRGHTGPLEQRLLLLAGRRPAVLNFTATI
PKDEAARLNPVFDRIFASIRVAGSPEG
Download sequence
Identical sequences A0A150QP65
WP_061608134.1.58895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]