SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151EDI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151EDI8
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.11e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000192
Further Details:      
 
Domain Number 2 Region: 167-291
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.34e-35
Family Anticodon-binding domain of Class II aaRS 0.0000578
Further Details:      
 
Domain Number 3 Region: 304-361
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.00000000000275
Family C-terminal domain of ProRS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151EDI8
Sequence length 361
Comment (tr|A0A151EDI8|A0A151EDI8_9EURY) Proline--tRNA ligase {ECO:0000313|EMBL:KYK26690.1} KW=Complete proteome; Reference proteome OX=1803822 OS=Euryarchaeota archaeon SG8-5. GN=AYK23_02670 OC=Archaea; Euryarchaeota.
Sequence
TSETAMYPIFSLWVRSHADLPLKTYQIVNVFRYETKQTRAFIRMREIHFFEAHTCHVDFE
DAERQIRENLEIMERLAKKLCLPYVLCKRPDWDKFAGAFYTIGIDSLMPTGRTLQMGSIH
QYKENFSGPYDITYEDADGEHRHVHQTTFGMSERILGALISIHADDKGIVLPPDIAPIQV
VIIPILSKKDKDKTIQYCDDLSRVLKSIGVRAHMDDRELRPGNKFFDWELKGVPLRIEVG
PKDMEAGVITTARRDSGEKGQITKDRVASGVQDLLADIQESLYRKVKDEMFKHIHRVSDL
AGVKEGINSMSWCGVEDCGHEIEDVTEMAILGVPTSAEETEGGCIVCGAPTKQVIYVAKT
Y
Download sequence
Identical sequences A0A151EDI8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]