SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151ER05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151ER05
Domain Number 1 Region: 11-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.03e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000491
Further Details:      
 
Domain Number 2 Region: 276-401
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.96e-31
Family Anticodon-binding domain of Class II aaRS 0.0000548
Further Details:      
 
Domain Number 3 Region: 404-472
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.0000000000000118
Family C-terminal domain of ProRS 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A151ER05
Sequence length 472
Comment (tr|A0A151ER05|A0A151ER05_9EURY) Prolyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_01571} KW=Complete proteome; Reference proteome OX=1803818 OS=Thermoplasmatales archaeon SG8-52-3. GN=AYK22_02895 OC=Archaea; Euryarchaeota; Thermoplasmata; Thermoplasmatales.
Sequence
MPETKVKKTKDFNEWYNEIVELADLCDKRYPIKGMNVWRPYGWKLMTHVDQLIRDEMSLT
NHQEVNFPLLIPESSFKKEEEHIEGFGSEVYWISHAGLNKLEERWLLRPTSETAMYPIFS
IWIRSHADLPLKTFQIVNTFRYETKQTRAFIRVREIHFFEAHTCHVDFNDAEKQIQEDKE
IAKRLFDKLSLPYILSKRPEWDKFAGAFYTISIDVLMPSFRTLQLGSIHQYKDNFSKPYN
ISYEGEDGKHNYCHQTTYGMSERILGALVGIHGDNKGLVMPPEVAPIQVVLIPIIFKGEE
KNVLDACDDLSLKLSNECIKSFVDKRDITPGNKFYDWELKGVPLRVEIGPRDIKNNQIVI
VRRDNSEKQSLAKDTAVNKIKEELNMISKSLYDTAKKLLNENIKRVNTVDEAKNIKGIVE
LPWCGIKDCALEIENIIDGNTLGEPIDDNECNNSCPVCNNPAKTWMRYAKSY
Download sequence
Identical sequences A0A151ER05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]