SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151HA75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151HA75
Domain Number 1 Region: 41-154
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.0000314
Family Major surface antigen p30, SAG1 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151HA75
Sequence length 178
Comment (tr|A0A151HA75|A0A151HA75_TOXGO) SAG-related sequence protein SRS22I {ECO:0000313|EMBL:KYK66255.1} KW=Complete proteome OX=1130821 OS=Toxoplasma gondii TgCatPRC2. GN=TGPRC2_425570 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MKFSLLTLGALAFSAQQASIVRGDEEGTEQQTPGNVCSPNNSLSFNVTQAGQSVLFTCGE
TITTLDPAFNATFPEMYEGNSKVRILDFLPTATLQQVTKNPSTLNSLRSSQGGETYNFTV
PILPSEEHELHVNCTKAAQKSTENAGCKITFHIASSAVRAGLAMSAVVGVIASLLQFA
Download sequence
Identical sequences A0A151HA75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]