SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151HBJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151HBJ2
Domain Number 1 Region: 54-162
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.0000353
Family Major surface antigen p30, SAG1 0.0079
Further Details:      
 
Domain Number 2 Region: 181-292
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.0000994
Family Major surface antigen p30, SAG1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151HBJ2
Sequence length 324
Comment (tr|A0A151HBJ2|A0A151HBJ2_TOXGO) SAG-related sequence SRS39 {ECO:0000313|EMBL:KYK66705.1} KW=Complete proteome OX=1130821 OS=Toxoplasma gondii TgCatPRC2. GN=TGPRC2_281930 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MVHSWARAFMKRGVLAALAAVCIAARVSGTPATSNTCVLAEPGADLSVENHTRVALSVTR
AGQQVFFTCPDGSPLDPTRAVQQGRFYAASADGTTCLSSQAPEALSDKVPGSYLTVIKGE
GISETTVAFFVPALPATAQNVCFSCSGRAANKQDCPVVISIAGRTVGRAVEEDLTCNGEG
EKKIAVTEPGTLTLHCGTETPSADPTLAPGNVFTGADCTEKVKLNTVLKDATLEVKPQEQ
TPPAQNPDEKKDYVLKVTSMPEATQQICLKCVQLENEKTTTPQKTCTFKIAVGKDAEVDS
AGFRPSVVSGVAVGVFVLASSLIQ
Download sequence
Identical sequences A0A151HBJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]