SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151HR36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A151HR36
Domain Number - Region: 54-100
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151HR36
Sequence length 198
Comment (tr|A0A151HR36|A0A151HR36_TOXGO) Uncharacterized protein {ECO:0000313|EMBL:KYK71857.1} KW=Complete proteome OX=1130821 OS=Toxoplasma gondii TgCatPRC2. GN=TGPRC2_225102 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MGESEEPSSPASAFEAGSASQDGGIPAVHETPEEPSAATLTLEEAKLRKRKEKMREFRKY
LVDTHVVDALAKLLIALCEAEERPARPQEYFIDYFGEYRRRHCSGHAAAHASENLGSRLS
RRSKCNTKSPLVFYPGHLTSLTRTNDICREKQLGKRFTSLLGLVQWRRRPVPEHTPIQIW
LKNTVSCLLSLQKNLPSS
Download sequence
Identical sequences A0A086KEX4 A0A086LEJ6 A0A086LVU7 A0A086QL85 A0A086QMR6 A0A139XWM8 A0A151HR36 S7UWE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]