SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151IAU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151IAU2
Domain Number 1 Region: 14-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0039
Further Details:      
 
Domain Number 2 Region: 149-215,257-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000372
Family Motor proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151IAU2
Sequence length 395
Comment (tr|A0A151IAU2|A0A151IAU2_9HYME) Uncharacterized protein {ECO:0000313|EMBL:KYM96237.1} KW=Complete proteome; Reference proteome OX=456900 OS=Cyphomyrmex costatus. GN=ALC62_13107 OC=Vespoidea; Formicidae; Myrmicinae; Cyphomyrmex.
Sequence
MNVLLQKHGAKHICKVPEGLRELCTDITREVLRSQPRNIYCFVADYVEALLITRENAKVA
VKVVNNILLGSQAIVGILHRSGLSLEQIARAAPRIQTAFRAYLDAADMRATQVCDDTTCD
EKSKVSLQSILQATGVSLELAEKHATIIQVAFRGYYERMLLNESRGMIQWQRAATRTLEI
LRKAGASQAEASKAAVLIQATYRGYYTRRNLKIKMQAMQPQEEKKGSEIDMIEPKETVPA
VAWLDTMYEESELTPMKANEAASTIQKAYRRYRERKSNSEPPIESTKSAVVEAILKNLHQ
KVFDEVMTRADIPVEFGNREDLAKAGEELQRALKDRLTRARMAQEEYDEEEFAYEEEPDE
SFEKVVDLISVPEDWQEDREVEVKSERDGETNAYV
Download sequence
Identical sequences A0A151IAU2
XP_018402594.1.22276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]