SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151ICC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151ICC8
Domain Number 1 Region: 131-183
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000726
Family PDZ domain 0.043
Further Details:      
 
Domain Number 2 Region: 3-40
Classification Level Classification E-value
Superfamily L27 domain 0.0000335
Family L27 domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151ICC8
Sequence length 185
Comment (tr|A0A151ICC8|A0A151ICC8_9HYME) Patj like protein {ECO:0000313|EMBL:KYM97226.1} KW=Complete proteome; Reference proteome OX=456900 OS=Cyphomyrmex costatus. GN=ALC62_12093 OC=Vespoidea; Formicidae; Myrmicinae; Cyphomyrmex.
Sequence
MHTSQDLKSLISLLEDPVFRSIVTIQDSLIELNTQLTHHPSILPGDFDINISGQLELSVP
TTPVQPLGPNMYQDLYQDNSEQEDQRVPVAPLLHSSSEDTSAQVTSPSLVSEVMGGMPPI
TTPTYAKEFKKVIEAAAKGRQIFTVQLYKPEGTSLGFSVVGLRSKDKNEVGIFLQEIQPN
GIAGW
Download sequence
Identical sequences A0A151ICC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]