SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151LBR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151LBR5
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.7e-17
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.002
Further Details:      
 
Domain Number 2 Region: 79-179
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000103
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151LBR5
Sequence length 184
Comment (tr|A0A151LBR5|A0A151LBR5_PLARE) RNA polymerase subunit, putative {ECO:0000313|EMBL:KYN96381.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRSY57_1103200 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFSLFRIEDVLNIETHFKDSEIKNVIEFLLRAKYIDKVIQNVGFCVGLYDIIEIKNKEII
KGSGEIRLKVIFRLVIFQPFENEIIEGFVKSSDSNGIIISLGFFENIRVNSANLKEPKEL
EKKEWYWTYEGIKFFYTKDELIRVRILDTYFSDPNEMNKDESIPSMSITGTVQQDGLGLV
KWWK
Download sequence
Identical sequences A0A143ZZY9 A0A151LBR5 A0A2I0C1A4
XP_019970285.1.2076 PF11_0058.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]