SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151LF69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151LF69
Domain Number 1 Region: 87-124
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000575
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151LF69
Sequence length 286
Comment (tr|A0A151LF69|A0A151LF69_PLARE) Uncharacterized protein {ECO:0000313|EMBL:KYN97634.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRSY57_1017500 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVKIGKKLKGFNEGIPKLNTNINDKIINEKEENDAEERERQREKYKNEKEHELNEMIFEH
DDQQHIHEQYRKLYLENIKDSKIYIHDDLQYYLEKNNIPTLLVLLLYKILIEKPENVIKF
IIDQIYVFLFTKTETNKKRALLKPLECTFLQSCEEKEKKKKKEQHENNMINSLDEQMNPS
FHESINDALQNNVLQKNNDIIESINYESFIKQHFFGLDNILEVVDFLKIENTEEIYYNNL
IHIIKNFQNPINNQILQRENMSYGQTISLNKALCLSETIYNNYFYN
Download sequence
Identical sequences A0A151LF69
XP_012763218.2.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]