SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151MD23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151MD23
Domain Number 1 Region: 157-192
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000889
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151MD23
Sequence length 217
Comment (tr|A0A151MD23|A0A151MD23_ALLMI) Uncharacterized protein {ECO:0000313|EMBL:KYO22411.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0002993 OC=Alligator.
Sequence
MEGQAQPELKDMQVTEVQEPAKPIVTDTSDEDPSPIVEFPPSVKPSPEVETPTSVEQPHV
VELPASVEQLPVAEAQQFVDDSSVAETRGSIDQSPAATASVDKSGSMPQASVDKSPRAML
RASVDQAGGAELKALGDEFPEIEQPMVYEDPFEVSLMYMEKHNILQIFQEITENLVYKKP
DEPLQFMLLQIQSMMNAQQLGDSGEEKEEEPDLDIIL
Download sequence
Identical sequences A0A151MD23
XP_014459405.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]