SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151NJ60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151NJ60
Domain Number 1 Region: 130-317
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.58e-34
Family Nucleotide and nucleoside kinases 0.0000459
Further Details:      
 
Domain Number 2 Region: 373-554
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.03e-31
Family Nucleotide and nucleoside kinases 0.00000357
Further Details:      
 
Domain Number 3 Region: 4-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000222
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151NJ60
Sequence length 576
Comment (tr|A0A151NJ60|A0A151NJ60_ALLMI) Adenylate kinase isoenzyme 5 {ECO:0000313|EMBL:KYO36831.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0020867 OC=Alligator.
Sequence
MSTCEAKDYLARREIPQLFESLLNGLICYKPDDPVEFLESCLQKVKELGGSEKVKWDTFV
SQEKRTLPPLNGGQSRRSFFRNVMPDNPNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFEYISVGELLRKKIHNTSSNRKW
SLIAKIITTGELAPQETTITEIKQRLMQIPDEEGIVIDGFPRDVAQAISFEDQICTPDLV
VFLACSNQRLKERLLKRAEQQGRPDDNLKATQRRLTNFKQNAVPLVKYFQEKGLIITFDA
DRDEEEVFYDISLAVDNKIFTHKEAVAGSNELDRSLIMDSGDMLDTEFDFEDQADDQSSF
SGYETTGGFTGDLRQSTIIFVIGGPGSGKGTQCEQLAQKYGFVHLSIRDLLKRESSSLSE
RSKLIKDILECGEQVPGDIILELMKEAMMASLGETKGFLIDGYPQEVKQAVEFEEMVGEP
KLVLCMDCSAETMSSRLLTKSQSCECFDDNAETIRQQIEIYYQATEPVIAYYEKKTQLCK
INAEGTPEEVFLQACTSVDLFLKKEEAASSFSAEIQ
Download sequence
Identical sequences A0A151NJ60
XP_014449332.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]