SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151U6J7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151U6J7
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 2.24e-28
Family Steroid-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151U6J7
Sequence length 161
Comment (tr|A0A151U6J7|A0A151U6J7_CAJCA) Membrane steroid-binding protein 1 {ECO:0000313|EMBL:KYP74888.1} KW=Complete proteome; Reference proteome OX=3821 OS=Cajanus cajan (Pigeon pea) (Cajanus indicus). GN=KK1_007581 OC=Phaseoleae; Cajanus.
Sequence
MPPLRPPVQLGEITAEELKAYDGSDLEKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGK
DASRALAKMSFEEKDLTGDISGLGPFELDALQDWEYKFMSKYVKVGTVKSEVPVTEPEST
SEPSESTSRDIDAAKPTEDAKSEHVAVKSDETPSNVEADKE
Download sequence
Identical sequences A0A151U6J7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]