SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151ZAB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151ZAB2
Domain Number 1 Region: 18-60,99-174
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000575
Family Pseudo ankyrin repeat 0.0071
Further Details:      
 
Domain Number 2 Region: 625-684,713-747
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000196
Family Pseudo ankyrin repeat 0.033
Further Details:      
 
Domain Number 3 Region: 244-337
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000432
Family Pseudo ankyrin repeat 0.03
Further Details:      
 
Domain Number 4 Region: 414-508
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000405
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151ZAB2
Sequence length 918
Comment (tr|A0A151ZAB2|A0A151ZAB2_9MYCE) Uncharacterized protein {ECO:0000313|EMBL:KYQ90879.1} KW=Complete proteome; Reference proteome OX=361077 OS=Tieghemostelium lacteum. GN=DLAC_07750 OC=Raperosteliaceae; Tieghemostelium.
Sequence
MDNTVNCYKYYKYVFSNQFLREKIFSFVKSKNGKKYQDIDNVNWILGNGYFQLLKDKILR
NEDLYHWSPKHLHMLAEHGDLELLKIVDELPGLYYTSTLIDIASTKGHLDVVKWLHYNKA
IGCSNYAMDGAATNGHLEIVKFLHQNRSEGCTNVAMDAAAGNCHMDVVRFLHENRSEGCT
TEAIDKCCANTDHDKALEMVSWLLDNRCEKVSLRGIAGLGKSGNIKLFDFLKQRKTFREV
TLGLFVYSCAMGTDKFLDHVLSDKTLDLGFLISSTQRQTVLAYKAAECNHLGVLKVLHKH
FLLDPQMKILDKASRHGLEIVQWLFENGYNEHTKNAFNRVKDLETIKYFHEHSKVGCTKS
LADSNYDNLEILKFIFSNRTEGCSKQCFMLCCEEGLLENVKLIAEKYPTAITNHVYFSVA
AGGHLPVFQWAESHFGKDYQFSQELLDGVLMEMVSNGRLELFKYICENYKNNPSFSTGLL
DCNPSDKLAVLANASLINNHLEVYQYIKRDLHFDEDKMYPFYRIIEAIVKQEFDKVDEYT
TNYGKVGTVGKLSHTSVKKLYLVAAKIDNPSIMGLLLMNLPYFDLDWSTYEGREPLIMCL
EFSYFDTVKLFLGKHSCEEPIVEELFLQCCEMGQIQILDYLRSLNCQFLQRTKFIEQAVG
TSIEFNKLSVYNYLVAKHRYNPVIAKTFFDAYIEVVSRNNYTLFVKSLAEKAQLKSNTLL
EAISKSRKSILKYLYSKRQDINWESLKKGPGYNSVIEIIKEELKTSSDQTDNWLDEDENH
SLELDKSKQMEKYYKDQEIGLTYLNDYSTYSSLEFNKNGIQIDEESDNVDTDNSHFHQSQ
SDYSSDSVYSDEDFEEDEEDEYIDEDEYIYEDEYYDDDDDEMDEDEDEDVEINDDDLIYE
SEDDNEEESEEDNDPAMS
Download sequence
Identical sequences A0A151ZAB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]