SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151ZAF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151ZAF0
Domain Number 1 Region: 283-430
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000355
Family Ankyrin repeat 0.0087
Further Details:      
 
Domain Number 2 Region: 133-241
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000157
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A151ZAF0
Sequence length 734
Comment (tr|A0A151ZAF0|A0A151ZAF0_9MYCE) Uncharacterized protein {ECO:0000313|EMBL:KYQ90903.1} KW=Complete proteome; Reference proteome OX=361077 OS=Tieghemostelium lacteum. GN=DLAC_07776 OC=Raperosteliaceae; Tieghemostelium.
Sequence
MVELGEELFFKVYRNKFLNLKIWSLVKTDRWIKAGIHKCIREPYHWDDMTLIDSWICRNG
HFQLLLDKVRYDPTFKMSFIGVKYLMESNNDYTVFKACYDRFTTVFHMASKWTRAKAYTF
GINSKFYLTDLACNVFDNLKIVEFLLQKKQFPFSVRALYNSIASKNIQLVKVFSRLLRTK
IMNDFDVYNTVMVACVKSKSMELLRYFIEDFGLTRDIKMSSTVQKEAMLNENIEILEYLY
DRAIGRVPLNFINKLVKVKYHKEMITKVISMYPEMQLKEYGMDYACQFQDLDTIKLLFNT
YHVKPSSNGFKAAFREGNLEKVKFIHSIYSEYLDGDCTLEMKLAIVKNHLHIVKYLFESK
FPCHSLGHALRSPCYYGNTEMFKYLLHNGICSITSENAGKYFDLAVKCVGGSQEIIHYLL
DNYGNEFPENGISLSSIVAKGLLQNAKLVIERHLPYYKSIGIISAAIKYNDYALTEYLLT
SENNLIFHQKTMVMAIEHSDKRFLPLLLKYMDRYAMKTSMRIDALESTLDSIKYIYDHRK
DGIYQLKEDYLIIHAKVEVQSNLNYIDVEVPLKTRIKLCLPISKCILTSPKETLEYLVDI
GFPLDEYTTRAYVLYFIKNKEFEFIHWLGSRVIENYRLCNFLISSIVDSSNIIIPQYAIP
AFHFKFLLRENILNEDIICQYLTATDITPFLIKTIDKRFPSLSPTHSVFIQNKIMEYKKK
EQLRQKLMEEGRYY
Download sequence
Identical sequences A0A151ZAF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]