SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151ZDA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151ZDA3
Domain Number 1 Region: 82-108,136-205,235-302,422-501
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000316
Family Ankyrin repeat 0.0054
Further Details:      
 
Domain Number 2 Region: 334-447,485-496
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000144
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151ZDA3
Sequence length 553
Comment (tr|A0A151ZDA3|A0A151ZDA3_9MYCE) Uncharacterized protein {ECO:0000313|EMBL:KYQ91905.1} KW=Complete proteome; Reference proteome OX=361077 OS=Tieghemostelium lacteum. GN=DLAC_07141 OC=Raperosteliaceae; Tieghemostelium.
Sequence
MELLRYKLKHLPSFKITESSILDFCLNIRDFDLFQQVYQKYSDYFLAINGKSQLLSNVAL
SGLLDAVKLIEKRGSFDKRRYLWNACKSGNCDLVYYVLQDADIVNLETAHPSSSESSLVA
AVPYKEMIRHFAQRFPSTDEVVKRQQFHEATAEASKLGLLENLKLLIELFGMKPSLCCID
IAAAYGHLDVVDYLNSTNTPFEITPFAIYKTTQLGKFENLKELVSRGFPVSSSVLSMASK
KGHFEIVKYLVETLNHSVDNTSVKGAMKHNHYEILEYLLQRASMAPNYNNNVIFESCPTH
YMLSHRNLKMIKLIDTYSHMFESVRYSHFNSLISDIHSKEGNDIIQYVISTRPTEFTSSF
YIEYLMRKAVASKDKELVRCVTSNEGLSQAIRNQFVNILDLSCEYGSIEIVKDILEGVQT
NLGLSLNSGIDFAIKKDQTAIVKLILEMKPEILYSTTSMVVAFEMNYNKTVLILLNHWVP
RCANKKDPTRPLRYAIKESLKLIVSKFNMETLQILIDYKMATIEDLEQYIRLDQKQKFEK
FIQTYKPKYSIPK
Download sequence
Identical sequences A0A151ZDA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]