SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151ZDS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151ZDS7
Domain Number 1 Region: 331-353,387-476
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000405
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151ZDS7
Sequence length 918
Comment (tr|A0A151ZDS7|A0A151ZDS7_9MYCE) Uncharacterized protein {ECO:0000313|EMBL:KYQ92060.1} KW=Complete proteome; Reference proteome OX=361077 OS=Tieghemostelium lacteum. GN=DLAC_11670 OC=Raperosteliaceae; Tieghemostelium.
Sequence
MMTSKWISNNGYFHLLVDKIENQKGFKLCYEAILIIVKKCNDHNLFRRIYDRHSGLFKQT
ERHYRYQTPPQVLLDNACLGNGNYSIVEFLYSQKFHFTNESLINSATVGDLKKFCLFLPV
FNLNTPILQEKIFNEILRNGHFDILRYLMEKHHVLPRNFTGASQFPDIMWYLVNSGHFDC
DSSQFKESLSECVSKNPSVFKTWVQECSEEFQIDLSLEIAISNENIEILDYFYKKQPSLF
REDSLIFGIFKSIYHYKLKSFQFLMEKLILLYNDIDSVPVIEMRTAHFKSLCMNGSNEML
QCVMGYKMFNFNILEVEENFYFNLVSCFKCKNLENFQYLCKRFYDFIQKESVSNLFCFSK
QSLGTIDSLDYLLVLEQYEIPINYHSLLHYCITVGSLQLPVLKHLLKTNTKLFDIITFGQ
LRIVMKLADHTITELILENVEMIDSQYSSNVNFCGSIEVLEYLLEKQLTPDNPNINYQSD
TSTLILKCNKGGELKVKLLLPPLTCNRDPKHAIDIVLKSGLNPDICLDIPYLLHFVKTKQ
WDVIKQISDQFSTLPRTLKPITEFILQQVRPDKLYHCIDLYNISNNQLEILENSGILDGI
EYLNVGVEKLYNIKSLKYFYYNHPNLFNKCIANDILLNPKLKLDNEECIQFLIHKGIKIG
LNQMKQIVVRAIQLNNIHRADKWSFIKDPYYKELLELAYREIYNLKQFSFYGIENKLVRT
FPVLWKLIRPPKDELLPTHAFITIEDNLIPFLTNNIPKQPDNPLLALKMSELVDRPLLDR
EILFIFLKQLLNTLLGRTDIMSKGYTFTDDKWLNFDEIPQMKVNVNLKLRIFDVTDYRNQ
KHYIQQLGYAFISDIEKAALNFKPEVTTTQIKIYFSEVDLKIISNKNTELYFRNYNFCKS
VWSSIFFNAFNNLKSKLN
Download sequence
Identical sequences A0A151ZDS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]