SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A154PNU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A154PNU9
Domain Number 1 Region: 14-172
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 8.24e-36
Family Thiamin pyrophosphokinase, catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 178-264
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 4.32e-24
Family Thiamin pyrophosphokinase, substrate-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A154PNU9
Sequence length 273
Comment (tr|A0A154PNU9|A0A154PNU9_9HYME) Thiamin pyrophosphokinase 1 {ECO:0000313|EMBL:KZC13134.1} KW=Complete proteome; Reference proteome OX=178035 OS=Dufourea novaeangliae. GN=WN55_05366 OC=Apoidea; Halictidae; Rophitinae; Dufourea.
Sequence
MQHDTDLGKTEWNLLKIFDCSPQCKYAVIILNRPLHWKHDILFRIWENAQINVTVDGGTH
RWVDYLKEQGIDLLNGKHSQYVPNLITGDMDSCSPAVLEKLRSMGSVIIETPDQDHSDYT
KALRQLRQYAKKKHINLKAVYVFVDSSGRFDHIVGNINTLYKSDKLIGQIQVIQIASDSL
TWVLKPGFHSISIPNILVQNNTWCGLLPIGTPVNCISTTGLKWNLNNATMQIGGLISSSN
TYDNCSEVNVSTDSVVIWTMGIDPLQESMCSVE
Download sequence
Identical sequences A0A154PNU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]