SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A154PP25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A154PP25
Domain Number 1 Region: 110-230
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-35
Family cAMP-binding domain 0.00000134
Further Details:      
 
Domain Number 2 Region: 239-361
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-32
Family cAMP-binding domain 0.00000182
Further Details:      
 
Domain Number 3 Region: 10-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.96e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A154PP25
Sequence length 372
Comment (tr|A0A154PP25|A0A154PP25_9HYME) cAMP-dependent protein kinase type I regulatory subunit {ECO:0000313|EMBL:KZC13619.1} KW=Complete proteome; Reference proteome OX=178035 OS=Dufourea novaeangliae. GN=WN55_05171 OC=Apoidea; Halictidae; Rophitinae; Dufourea.
Sequence
MAANLEEEQSLRECEEYVQRHNIQQVLKDCIVQLCVGRPENPISFLREYFQKLEREQAHD
AKQQIATSPEDTEDIPAGQQGPQVPRRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALS
KAITKNVLFAHLDENERSDIFDAMFPVTFLPGEAIIRQGDEGDNFYVIDQGEVEIFVNGE
LATTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEF
LSRVSILESLDKWERLTVADALEPVAFDDGETIVRQGEPGEDFYIIVEGTAVVLQQRSEN
EEPAEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRN
ITQYNSFVSLSV
Download sequence
Identical sequences A0A154PP25
XP_015436201.1.55303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]