SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A156DCI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A156DCI5
Domain Number 1 Region: 7-159
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 4.32e-46
Family ChuX-like 0.0000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A156DCI5
Sequence length 164
Comment (tr|A0A156DCI5|A0A156DCI5_ENTCL) Putative heme iron utilization protein {ECO:0000313|EMBL:SAD90190.1} KW=Complete proteome OX=550 OS=Enterobacter cloacae. GN=SAMEA2273167_02516 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MSHVSLQDFLKTEPDGTLEAIAAQYNTTLLEVVKNLPSPTLVSGSQFDTVWETVCEWGKV
TTLVHTADVILEFTGELPSGFHRHGYFNLRGKKGMTGHIKAENCTHIALIERKFMRMDTA
SILFFNQAGSAMFKIFLGRDEHRQLLAEQVSAFHALSSSLKEHA
Download sequence
Identical sequences A0A156DCI5
WP_063941329.1.17699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]