SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A157T574 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A157T574
Domain Number - Region: 5-56
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 0.0034
Family Dom34/Pelota N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A157T574
Sequence length 186
Comment (tr|A0A157T574|A0A157T574_SULSF) Uncharacterized protein {ECO:0000313|EMBL:SAI86557.1} KW=Complete proteome OX=2287 OS=Sulfolobus solfataricus. GN=SSOP1_3003 OC=Sulfolobus.
Sequence
MDETEIEKLYNGKLDDLYYLYSHANSEDIIRWMKNRKTAEMRTYEVEGDSEIVVVIPTAD
VNGKLARNVREVYKGFHIIFIESFGSLFNYARSVNFGLKSSLRLKPRWVIISNDDVLSVS
GNIKDELSIVSRNVNLVMASRSNYHTYPVVLVKPNEYFIRGMKIFGKVLNFSPAEVYGEI
LSHKQK
Download sequence
Identical sequences A0A157T574 Q97UU0
gi|15899617|ref|NP_344222.1| 273057.SSO2903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]