SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158L097 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158L097
Domain Number 1 Region: 17-54
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000000000912
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00056
Further Details:      
 
Domain Number 2 Region: 3-21,48-79
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000275
Family Nucleotide and nucleoside kinases 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A158L097
Sequence length 116
Comment (tr|A0A158L097|A0A158L097_9BURK) Adenylate kinase {ECO:0000256|RuleBase:RU003331} KW=Complete proteome; Reference proteome OX=326476 OS=Caballeronia choica. GN=AWB68_07974 OC=Burkholderiaceae; Caballeronia.
Sequence
MLEIDVPFNEIIVRMSGRRVHAASGRTYHVRFNPPKVENEDDITGEPLIQRDDDQEATVE
KRLDVYVAQTRPLIEYYNQWSRSDDPLASMRPPRFAAISGLGSVDEIRARVFDALK
Download sequence
Identical sequences A0A158L097
WP_087649755.1.97593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]