SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158NI69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158NI69
Domain Number 1 Region: 123-196
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.44e-30
Family AN1-like Zinc finger 0.00016
Further Details:      
 
Domain Number 2 Region: 11-57
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000101
Family A20-like zinc finger 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A158NI69
Sequence length 201
Comment (tr|A0A158NI69|A0A158NI69_ATTCE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:XP_012057227.1} KW=Complete proteome; Reference proteome OX=12957 OS=Atta cephalotes (Leafcutter ant). GN=105620332 OC=Vespoidea; Formicidae; Myrmicinae; Atta.
Sequence
MERESNPMQALCRSGCGFYGSPATDGLCSLCYKENLKKKQQPPVSAATVPTSQTVSSNAG
TLQSSFGSPAATGTTAQPTIPTIPQSTSDLPSPKEVNREDQESEVGVSSAVAEGSSASSG
DVDDSFDGKETDKESKKKKNRCAVCRKKVGLTGFECRCGGLFCAVHRYSDKHDCKFDYKE
MGAQEIRRNNPVVVGEKVQKI
Download sequence
Identical sequences A0A158NI69 A0A195BXK8 A0A195DF20 A0A195ESR3
XP_012057227.1.45171 XP_018049355.1.4000 XP_018049363.1.4000 XP_018049372.1.4000 XP_018353900.1.14990 XP_018353901.1.14990 XP_018353902.1.14990 XP_018353903.1.14990 XP_018353904.1.14990 XP_018353905.1.14990 XP_018373964.1.32933 XP_018373966.1.32933 XP_018373967.1.32933 XP_018373968.1.32933 XP_018373969.1.32933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]