SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158NV12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158NV12
Domain Number 1 Region: 234-366,393-419
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000266
Family WD40-repeat 0.029
Further Details:      
 
Domain Number 2 Region: 384-526
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000353
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A158NV12
Sequence length 1226
Comment (tr|A0A158NV12|A0A158NV12_ATTCE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:XP_012061370.1} KW=Complete proteome; Reference proteome OX=12957 OS=Atta cephalotes (Leafcutter ant). GN=105624624 OC=Vespoidea; Formicidae; Myrmicinae; Atta.
Sequence
MFALTGEVNFWTFDDNVNIEVTDFGAFKYHDKRIDGTYEEGKRSYCQERGMTYVPENKKR
NKLKHSIKYLEGQLRDNSVIYSQWYDDSVAQLMLSNGLLVQIQVCLFSGDVLEINFDKYL
IGKLSEHISDVIITKSHLVCTYNDNLVTLVYFTKSKTHIFDKISKLEPKLVTTDLFKPNG
RRLDKKIEVNKSTNLILIWRKSTMNEVYPWSPAMKQYHRANMHLFQLTGTKLELLCYIRT
EFDPLCITFDACDDNIIHSVEQKVSRKGEVTVEWRTYEVSRQNKLKRIAVISVPLPTHTS
CVRFSPNQELLLLCCIDGTIMMYDQIKSTSISVKAAFIPTLAAWHNDGIIFVIGNDRGQF
QYFDITLMCIKSQTLSDESMPANILDLSSYFKNQHALLHMEWNRKSDPNQIRYYNNGNSL
FLLLFERGPIGVIKVIEGDTLSGDELVRRYLSESRAEQATSLLLSMNWDTHPRVCMHSLN
QILNYLFKLPLTMEHEGLIQNALGSFHVPIKPISQTVEEEYGDEVRDLTRRFFHHLLRYK
MFEKAFRLAIDLNDHDLFMDIHFYATVLNDMELAIAAKEKAESILSRSNSCSGSHSTCSR
TSCSVCSDSKEEKEEEEQIEATYSEESEDSQKEKRLNLKRSRKYRYRKASSSNQIPPLPV
VHPHHTAKNTLCAPYNNIPSTIKTDYILIPSSFDTSNNILTTSFNHSSHISSPFLSSTSF
NKSLYSTHSNFTPISAANVINSSQVFNNASDDLMTTSFGSISFNESDVIVNDQSSNNFDE
RSYEQSLLNEISYSFSSSTTNVITTCAQDDSFISTPFNKPIYESEDIHSNNYLTSCLNVI
DNNVMSTSFGTRIANTPISHNNSVNALIANNNSETTFMLRGMKSSKISDKSLTKTLIDNT
HTTDQLPLSNNTCNNLMSTSFNNLEGYTTLESNDITFPNTFNNVNDQAVKHPIMEEKETN
ITIPSPPSLINSFSNCLHDLPRKNYLLSRSTQGLPNIKELEKFTSNKTHMPLCILQKQNS
TTSNIPENQKTSLSFKTYRYNYDLDYIPFQGSRDDTDLQLSQTVSKFSSRNFHPSYSIQH
GLFENKHSSRSSQTVNRETKMFSNVPPLPIINTSIASSKICSTCPSFADISSSLSNEKPK
VKFSDTVTHILVPGTVSKPVAILLPIRKDCLASKSCTSNIQPLISHNVRNSSIITSLPIE
TIDSNLRKTTMTEKSKENETIQQGTI
Download sequence
Identical sequences A0A158NV12
XP_012061370.1.45171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]