SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158QEB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158QEB3
Domain Number 1 Region: 184-306
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.37e-33
Family cAMP-binding domain 0.00000259
Further Details:      
 
Domain Number 2 Region: 314-435
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-33
Family cAMP-binding domain 0.00000438
Further Details:      
 
Domain Number 3 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A158QEB3
Sequence length 447
Comment (tr|A0A158QEB3|A0A158QEB3_HYMDI) Uncharacterized protein {ECO:0000313|WBParaSite:HDID_0000712301-mRNA-1} KW=Complete proteome; Reference proteome OX=6216 OS=Hymenolepis diminuta (Rat tapeworm). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MEDDLYVQELDDYVKRHNIHKILRESIVNLCLYRPENPIHFLREYFEALDVSSSNSDKPT
SNSTSKLTVTPPLKELCSVNSSYPSPSAGSEPSSLNPDNIPPDEPSTSTQRRYSGEQWSS
NQNGLSDGDDTSEVRLNSSPTLRASNSSCSVDPFNVTRRVRRGAVSGEVYTEEDAASYVK
KVVPKDYKTMTALSKAIARNVLFAHLDENERSDIFDAMFPLHRSKGDIIIKQGDEGDNFY
IIDQGEVDIYVNGELVSCIGEGGSFGELALIYGTPRAATVKARSDEVKLWGIDRDSYRRI
LMGSTIRRRKMYQDFLARVPILDNLEKWERLTVADALEPVRFDAGDRIVQQGDPGDDFYI
IIEGTAAVLQQPSENAEPVEVSRLGPSDYFGEVALLLDRPRAATVVAQSAMRCVKLDRKR
FERVMGPCSDILKRNIAKYNSYISLSV
Download sequence
Identical sequences A0A158QEB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]