SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158QIP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158QIP2
Domain Number 1 Region: 22-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.91e-106
Family Ankyrin repeat 0.0000002
Further Details:      
 
Domain Number 2 Region: 388-439
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000157
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A158QIP2
Sequence length 452
Comment (tr|A0A158QIP2|A0A158QIP2_HYMNN) Uncharacterized protein {ECO:0000313|WBParaSite:HNAJ_0000975501-mRNA-1} KW=Complete proteome; Reference proteome OX=102285 OS=Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MVSDPGLDIHRGTPKEPNNGLNALHLASKEGHLPIVRLLLDHHASIDAKTNRGNTALHIA
SLAGRFEIIKLLVERGADVNARSQNGFTPLYMAAQENHLNIVEYLLNNGADQSLATDDGF
TPLAVALQLCHDGVVSMLLERDSGGKGRLPALHVAAKKDDVHAVSLLLSNNDVNVNHAST
RGFTPLHIAARYGNLKVARLFTSNGADDSITPLHLAAKWGKAEMAQLLIDKGAQLDARTR
DGLTPMHTAARSGHTNVVQILLNAGASITAKTRNGLSPLHMAAQSDHADTAKLLLKRGSP
PDDVTMDYLTPLHIASHCGNTKVAQVLLEHKCDPNLRAFNGFTPLHVACKKMKVKIVELL
LKKGANVDATTQAGLTPLHAAAFVGCAEAVKMLLQRGANGNQVTMRGETPLHFAVRGRHI
DTIKILLKHSASVNAKAKVSNLLYGECIHSVH
Download sequence
Identical sequences A0A158QIP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]