SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158QYH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158QYH7
Domain Number 1 Region: 45-342
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.41e-70
Family WD40-repeat 0.00000000425
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.00000000144
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A158QYH7
Sequence length 344
Comment (tr|A0A158QYH7|A0A158QYH7_NIPBR) Lissencephaly-1 homolog (inferred by orthology to a C. elegans protein) {ECO:0000313|WBParaSite:NBR_0000850301-mRNA-1} KW=Complete proteome; Reference proteome OX=27835 OS=Nippostrongylus brasiliensis (Rat hookworm). GN= OC=Nippostrongylus.
Sequence
MSGMLEKKWTSVLRLQKKVNDLEAKLAEAEKEINHGAPSREKRQPAEWIPRPPERYALTG
HRAPITRVVFHPVWSVMASCSEDSTIKVWDYETGEFERSLKGHTDSVQDVAFDKTGKMLV
SCSADMSIKVWEFGGSYACIKTLKGHDHNISSVASGYCVHTFRAHSEWVRMVRVSPDGVL
FASASNDQSVIVWSLQSKTVKATLREHEHVVECIEWAPDTALAPIRTEAGHKANGDLGAG
PTHVVVSGSRDKTIKVWDALTGTVMFSLIGHDNWVRGLRFHPRGKFLVSVADDKTLRVWD
IAQRRCAKTIDAHQHFVTSVDFHSTAPYVITSSVDLTCKVWECR
Download sequence
Identical sequences A0A158QYH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]