SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158R8T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158R8T6
Domain Number 1 Region: 2-51,92-230
Classification Level Classification E-value
Superfamily Proteasome activator 8.76e-64
Family Proteasome activator 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A158R8T6
Sequence length 237
Comment (tr|A0A158R8T6|A0A158R8T6_TAEAS) Uncharacterized protein {ECO:0000313|WBParaSite:TASK_0000606601-mRNA-1} KW=Complete proteome; Reference proteome OX=60517 OS=Taenia asiatica (Asian tapeworm). GN= OC=Cyclophyllidea; Taeniidae; Taenia.
Sequence
LQRYKEQTKVDGETLVRTVFPKRVFEMRELLASKLFNFEPASVYQKVNLPVPLIGEQNGV
PPAGAGLHPDGDGTVQKPLTGSPVFTFPGGVVSHNTHIKAMIEATKPHLTQLMVEAQLVR
MWIQFNVPRIEDGNNFGVSIQEDVLSEVSGIERDALTFLDQFTRYYASRGKLVGKAAKFP
HIDDYRECIRDMDEKQAISMRYVIMEIRNHYAVLHDLIVKNLDRIKVPRSNNTMTMY
Download sequence
Identical sequences A0A158R8T6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]