SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A159ZRC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A159ZRC9
Domain Number 1 Region: 398-447,483-568,599-604
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000017
Family Pseudo ankyrin repeat 0.048
Further Details:      
 
Weak hits

Sequence:  A0A159ZRC9
Domain Number - Region: 212-246,343-391
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00127
Family Ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A159ZRC9
Sequence length 633
Comment (tr|A0A159ZRC9|A0A159ZRC9_MIMIV) Putative ankyrin repeat protein {ECO:0000313|EMBL:AMZ03216.1} OX=1835008 OS=Mimivirus Bombay. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MESKTYYLLRTEEYGDYEMFTIVEDKYFFDHIHRSDKITQVKPDYDRFGFKICEDEQTYL
TNYIIELETLSLFDIDTVDRLIASTENKLGIYGHLYCLYIKNNRLDLCDYLIQSNYEYDP
TSNCDDILEFVPDENEADVLMYIINNNNFFKIKWSEIATHVIGYTECYDVIDYLVNFLKQ
IDCNIDYDTIIEECYYSRDGYSDDTFFNETIKILLRLECVNVNKLLEIACIFSITEIVTH
LLDIGTEYDFNTILKSHISLHILKIFLNRGNILDSDSVKILLSTNKGWKFSQTFSYLMDE
QYITQELVDKNLVDIVIDNNFPVLKRLIEKFDLSELIDYDVVMKKAIMNSSLDIIDYCIS
NGTDVNNYMTYAFQHYNQSCFTHLLNQGGTLSTDNLVYRPENLRESKYQNVQYIDIVIDN
NLDSIENILDNVLEYYHYNTDICNYVLNKINYNSIVLPKLTNKIIRNYYYNECINDKYID
LVKSKINPNDIDKSIIAIVTDDFDSAKQLIMENNLYDNLKILFVAIMKYDIDMLKFLFEI
NDNSNDYLQWTLLFSLVGNCKSVKFIMEDIGVKPERMKEFRFIMKKSRDTCTKYFKLNGY
DVSIDNEDNCDEYPVVKFFKEMGIYLGDYIYTL
Download sequence
Identical sequences A0A0G2YE76 A0A0U2K3U1 A0A159ZRC9 A0A1E1EUG7 E3W085 G8EBM9 J2YVY3 Q5UPR6 W6GFY4
YP_003987305.1.55212 gi|311978185|ref|YP_003987305.1| YL774_MIMIV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]