SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A160VT34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A160VT34
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 2.75e-22
Family Nucleolar RNA-binding protein Nop10-like 0.0000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A160VT34
Sequence length 60
Comment (tr|A0A160VT34|A0A160VT34_9EURY) Ribosome biogenesis protein Nop10 {ECO:0000256|HAMAP-Rule:MF_00803} KW=Complete proteome OX=54262 OS=Thermococcus chitonophagus. GN=CHITON_0857 OC=Thermococcus.
Sequence
MRFRIRKCPKCGRYTLKEICPVCGEKTKVAHPPRFSPEDPYGEYRRRLKRELLGIGRKEK
Download sequence
Identical sequences A0A127BCD5 A0A160VT34
WP_068324743.1.64818 WP_068324743.1.81274 WP_068324743.1.86604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]