SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A161M7N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A161M7N7
Domain Number 1 Region: 237-368
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.3e-36
Family cAMP-binding domain 0.0000362
Further Details:      
 
Domain Number 2 Region: 102-225
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-35
Family cAMP-binding domain 0.0000285
Further Details:      
 
Domain Number 3 Region: 8-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000327
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A161M7N7
Sequence length 378
Comment (tr|A0A161M7N7|A0A161M7N7_TRIIF) Camp-dependent protein kinase type ii regulatory subunit isoform x1 {ECO:0000313|EMBL:JAS02484.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
MQRQHIGKIAVSNEFRQMMLEFTVTYLLEQPQDPVAFAAEYFQRLRSAERDIEDAQHLES
PSDSALEEDIQPPQGHLRQRRKSISAEAYNPEEDDGAAPEYYPKTDKERQILRNACQNIF
IFRSLDQDQWDEVINATFSKEVEKGEEIIREGDDGDNFYVIESGVYNVFKNVDGEEKKIY
TYYHAGSFGELALLYNQPRAATVKAVTDGKLWAMSRQTFRRIVLQRAFKKRKMYEGLIAN
VPMLESLKPYERLNLADALAPKTFTDGEIIIKQGDIADGMYFIESGEVQVTILNEEEEEI
EIKRLHTGDYFGELALVTHKPRAASVYAVGDVKTAYLDVDAFERLLGPCMQIMQRNISTY
EQQLIQIFGSKRQISDVR
Download sequence
Identical sequences A0A161M7N7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]