SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A161ZLG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A161ZLG1
Domain Number 1 Region: 9-54
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000144
Family Preprotein translocase SecE subunit 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A161ZLG1
Sequence length 58
Comment (tr|A0A161ZLG1|A0A161ZLG1_9EURY) Protein transport protein Sec61 gamma subunit homolog {ECO:0000256|HAMAP-Rule:MF_00422} KW=Complete proteome; Reference proteome OX=1679489 OS=Haladaptatus sp. R4. GN=A4G99_07410 OC=Halobacteriaceae; Haladaptatus.
Sequence
MDVKLDLASYLRVLKLASTPSWDEFSKIAQIAGAGILLVGLLGFVIFAIMSFINAAPV
Download sequence
Identical sequences A0A161ZLG1
WP_066143438.1.55049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]