SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A162AQB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A162AQB1
Domain Number 1 Region: 6-195,248-374
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.04e-37
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 575-746,879-991
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-34
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 842-1014,1045-1087,1161-1225
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-30
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 4 Region: 1128-1253,1339-1408
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000213
Family Ankyrin repeat 0.0062
Further Details:      
 
Domain Number 5 Region: 383-627
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000129
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A162AQB1
Sequence length 1634
Comment (tr|A0A162AQB1|A0A162AQB1_DAUCA) Uncharacterized protein {ECO:0000313|EMBL:KZN04323.1} KW=Complete proteome; Reference proteome OX=79200 OS=Daucus carota subsp. sativus. GN=DCAR_005160 OC=Scandiceae; Daucinae; Daucus; Daucus sect. Daucus.
Sequence
MDLDTLFDAAMAGDAAATAELEIEADRLYRFEETILHLQSEKGNTERVKFILRKFAHKNL
LAKLSRYKHTALHLAIYEGQTEVAEVLIDAACDLPPPSDDDHNPKLTSFQAFVRQGDKDM
DTALHAAVLRGNATIVKRLVEADPTDTHIQNNDGKTPMYIAVENGLNHIAEIISTTCKAP
SLDGPDGSTVVLFKDSSGKSPGGTLFKIMDRYAFFVAAIAGDAYAIAKLETQADILNRGE
ETTNAKRVRVILREFAKKNLLAKLTSEKQTTLHLAAIYGHTELAEILIDAASYLHPSDND
NTQEDPTTSFQAFLRQSDLNEDTALHAAVKKGNLAIVKLLVEADPSDTHIQNDDGKTPMY
IAVEQGLNSIAEVISTTCFAPSLLGPDCSTVVRDKNFDQAESPGGSLYKIMHKDALYAAA
IAGDADAIAALEMHADKLDKYEETILHTESENGSKEEGTAVIKLIIKAVKHANKHGTPDE
RSKRLMQFFTKTDEKRRMILELAVEEDHLDVVQLILAKNPAYHWPHRYPELIGIMPLIYR
AMDMDKENNAMVNLLTRVYQNGVQSSKTANVHKMISAIDSRKEEYVLSLLNNRGVQDLVT
FHDILGWTILHHAVYYEHNSIIGIIIEAQKTYGHGFRYPDRISTPFHVAVQKGYVSTMKL
LLRLWPSSSSAYIDVDRNGRNILHLAALQSGKEMIRCILKYCPQMYKEFVNKKDDDGNTP
LHLLICGGCFIPEFLKYQGLDIRIENEKRWIPRDMLYFQDQIVEDQVQIRIALDGIETDP
TGDGKFSRFVLPSRRMRKDVILDRQAKLMIHEKYTGIKEDPDVIANCFADAIAGDPISKA
VLRMKAYKLNELGETILHVESMKGEIENVRFIVSEFANKSLLGKLDRSKQTALHLAAQHG
HTQVVEALIDAARLLPNDAHNQVTFLQDFIRQADVQNGNTTLHLAVVNDNVAIVKLLVEA
DSNDSHVRNHEGKTPIYIAAENGYKNIVKVICTACTALSLDGPSTGKTTALHSLMQNIDQ
EGTEGESDVIGMMVDAAKRWSSAQNASTADFEALFNRTDELGRTVLQIAVERKDVNAVRL
ILKEDPAYQPGGEMKRNGLMRLICKAIDDECSDDIITSLSQTYKAGIIHHDPKDVLALIR
AIQDLDKDVVLSLLGKAQILATFTEDNGWTPLHYAVYYEFDVILDAMIKAQKDVGYPFVY
KDMETTPFYVAIERGYTSTLVRLMELWPTLSSDECSPYTLVTQDSQNMLHMAAVARARAT
ENRKDVADAIDNRKVFADSRKEMVQMELWPASSSDAYSPYTLIPQDGKNIHMAAAAHAAE
NRKVVAHVVDIVDSKKAAADNRKEMVQSVLKYCPNKYKDKILKQKDKNGDTPLHLLISHG
SFIPALLKHEGLDTMARNKRDFTPRDMLYVEDATVVDQVHIKIALDEVLTSKSGWKLWGR
RTEKKEDIWRCNKTPPSKRKEKDVKFEGEKKILEKQRTKDRKTYKMRTNTQILVTALTTT
VTFTVGFTMPGGLHQSGEDDEGLVILSRKTAFNIFMVSDALALLMSTSSLFFYFLESMNE
DLHQVSLLNASSTVLNILSISAMMVTFIAGTYVVLSGTPLLAIAICIIGSLFFLLILILW
IMKIVFDRYKRNKD
Download sequence
Identical sequences A0A162AQB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]