SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A162N4P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A162N4P2
Domain Number 1 Region: 136-265
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-32
Family cAMP-binding domain 0.000052
Further Details:      
 
Domain Number 2 Region: 260-384
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-28
Family cAMP-binding domain 0.00012
Further Details:      
 
Domain Number 3 Region: 9-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000214
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A162N4P2
Sequence length 401
Comment (tr|A0A162N4P2|A0A162N4P2_PHYB8) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=763407 OS=NBRC 33097 / NRRL 1555). GN=PHYBLDRAFT_117443 OC=Phycomycetaceae; Phycomyces.
Sequence
MEFISDTSTEQEFADIIQELTQDFYYQKPDDVLQFCTNFFQSRLSSQRSFWRGYITETFT
SHPTESSPSLTPALVQDPLEAYSSDEEDVFEDEDTFENEMIEFTAPISNRGRRTSVSAES
MTPLARGDKDYIQKIIPKTNAQKEQIQAAIRNNFLFRNLDENQHQDIINAMSEKQVLPNE
VVIQQGAIGDYFYIVGSGQLDCYINSDQQKVTTYGPGGSFGELALMYDSPRAATIVSVVS
GVLWALDRLTFHRIVVEHASHRRQMYESFLAEVPILASLDACERFKVADALEYVCFEEGE
TVVQQNGFGDNFYLIESGDALVYQTDVDGIQKEVNCLTKGAYFGELALLHDIPRAATVIA
QGRLRCATLGKRGFSRLLGPILDILKRNSENYAKVLQTTTI
Download sequence
Identical sequences A0A162N4P2
XP_018286548.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]