SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A162NEC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A162NEC7
Domain Number - Region: 68-81,121-156
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00837
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A162NEC7
Sequence length 308
Comment (tr|A0A162NEC7|A0A162NEC7_PHYB8) Uncharacterized protein {ECO:0000313|EMBL:OAD68774.1} KW=Complete proteome; Reference proteome OX=763407 OS=NBRC 33097 / NRRL 1555). GN=PHYBLDRAFT_63318 OC=Phycomycetaceae; Phycomyces.
Sequence
MSNINNTNNTNDLVIVSETSSKKYNTALTEFNSIFLVGRQFSSTVAVREAVKTYGATHNI
AFSTMFSSETCIKIICKHAGKYRDTHKAAKIALETSTSKESPLPGWERKHVKDTQKHGCQ
CFVYASKKKDGRVAVHLCEAQHNHPIEEDRKAYAMHQKLLPEDMALVTRHLENNDDVSII
FNSLKIYGYTNVVCQDIENIKQHFGKDYEGKEMFGFIITLQDLDFYIHYTVDNTDDKRIN
MVFFVHKNAIALQEKKWGFSWGFSWRFGLGLSCLLMLAFIHIPLYLPICYTLILIGSKRI
EKGFYWYE
Download sequence
Identical sequences A0A162NEC7
XP_018286814.1.77709 jgi|Phybl1|63318|fgeneshPB_pg.7__18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]