SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A162SYF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A162SYF9
Domain Number 1 Region: 7-60
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000301
Family Collagen-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A162SYF9
Sequence length 75
Comment (tr|A0A162SYF9|A0A162SYF9_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:KZL92030.1} KW=Complete proteome; Reference proteome OX=1121326 OS=Clostridium magnum DSM 2767. GN=CLMAG_18360 OC=Clostridium.
Sequence
MTEAASKTITIQSNSNNSSDFITVTLYDSNGNLAYINQCSNGTMQLNTILAPGKYHGFVK
ASSMDKVTISEFQVN
Download sequence
Identical sequences A0A162SYF9
WP_066621172.1.54356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]