SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A162W8U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A162W8U5
Domain Number 1 Region: 323-438
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-32
Family cAMP-binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 181-318
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-27
Family cAMP-binding domain 0.0000324
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000222
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A162W8U5
Sequence length 459
Comment (tr|A0A162W8U5|A0A162W8U5_DIDRA) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=5454 OS=rabiei). GN=ST47_g9963 OC=Didymellaceae; Ascochyta.
Sequence
MSLPPDYANEIAALDREILKHKPHDILQFCASFFNRRLESQRAEFLLSQQHSSHQGRAEH
SFPGNNPFGTSPSSGGFAKSPMQRLEEEEEGDLMASPTASSFARADLNNAPPTTHGESSF
GSLGSFGNFGGFGGSSKNEVTQMPPIAGGSTPNNYNTNRRVSVSAESLNPTSADNDSFTA
PYHHKTDEQVSRLRSAVSGNFLFSHLDDEQSAQVLGALHEKPIPTKGIKVISQGDVGDYF
YVVEKGAFDIHVNKSGKLEAGVDGLGAKVGSVGPGGSFGELALMYNAPRAATVISAEPST
LWALDRVTFRRILMDSAFQRRRMYEGFLEEVPLLSTLTPYERSKIADALETKKYPPGTEI
IREGDIGESFYILESGEAQVYLRGNDQPVKRYNKGDYFGELALLNDAPRAASVVSETEVK
VATLGKNGFQRLLGPVEGIMRRNDPSKEGDNIDPLSRNS
Download sequence
Identical sequences A0A162W8U5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]