SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A163JZK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A163JZK4
Domain Number 1 Region: 30-120
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 9.15e-18
Family PsbU-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A163JZK4
Sequence length 120
Comment (tr|A0A163JZK4|A0A163JZK4_9PROC) PSII-U {ECO:0000256|HAMAP-Rule:MF_00589} KW=Complete proteome OX=1723647 OS=Prochlorococcus sp. MIT 1303. GN=PMIT1303_00043 OC=Prochlorococcus.
Sequence
MKRLLSLLTGVLVMTGLLMALIFPQSAYANVSDDKLGDRGDKVDLNNSSVRAFRQFPGMF
PTIAGKIVVGGPYSSVSDASSVLDASQKSVFDKYKDNFTVTDQEVAVNEGFDRINDGQYR
Download sequence
Identical sequences A0A163FAM4 A0A163JZK4
WP_063395094.1.43717 WP_063395094.1.68590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]