SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A164N2P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A164N2P8
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000275
Family NfeD domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A164N2P8
Sequence length 143
Comment (tr|A0A164N2P8|A0A164N2P8_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:KZM73914.1} KW=Complete proteome; Reference proteome OX=455432 OS=Nocardia terpenica. GN=AWN90_27265 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MAAILWLVAGVLLAAAEMLTGDFTLLMLGGAALVTAGVAGVAHTSLVVDAIVFGISALAL
LFLIRPMLLRRFAVPPPTATNVHALPGKTAKVLETVNEDTGRVKIDGEVWSARSFDPSEE
YAEGETVYVMKIDGAHAVVWKGP
Download sequence
Identical sequences A0A164N2P8
WP_067595846.1.63008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]