SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A164SJM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A164SJM3
Domain Number 1 Region: 32-208
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.0000000000071
Family Crystallins/Ca-binding development proteins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A164SJM3
Sequence length 231
Comment (tr|A0A164SJM3|A0A164SJM3_9CRUS) Uncharacterized protein {ECO:0000313|EMBL:KZS09691.1} KW=Complete proteome; Reference proteome OX=35525 OS=Daphnia magna. GN=APZ42_025989 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MVNFLSIILPILFFVLAPSGIQGQSDHTLQLYDGPLSSPGSWISVNNYVENLQNYAFNDL
ASSMCVIRGIWLFYENPSYNSVFLGLSAFYWGENFCEDLPTGLNNQVSSVRYAGSPYGFQ
ADSINIYQVDWFQSYEVFAATDSLDLSPYYGGSIIVTGRSYWTIYDSPNYQGYRVCVSPA
DITYAYPGFYTQASEFGFSGRVIRSARRGCWTENNFRPTFSAQPGKLYRRN
Download sequence
Identical sequences A0A164SJM3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]