SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165DIC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165DIC2
Domain Number 1 Region: 64-170
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.57e-25
Family Steroid-binding domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165DIC2
Sequence length 175
Comment (tr|A0A165DIC2|A0A165DIC2_9BASI) Cytochrome b5 {ECO:0000313|EMBL:KZT52866.1} KW=Complete proteome; Reference proteome OX=1353952 OS=Calocera cornea HHB12733. GN=CALCODRAFT_501776 OC=Dacrymycetes; Dacrymycetales; Dacrymycetaceae; Calocera.
Sequence
MISLIMRNEELVESIKLPVNGALLFAIAFLLYRIVWPAIPQPKEVPKSYKDGYSWMPDKH
PQVALFRQYTPMELKKYNGVEDKRILLAINGKVFDVTAGAGFYGPDGPYGNFAGRDASRG
MAKQSFDADMLSPVEGPIDPLKDLTSEEWSNMRGWEEHFTNKYIVCGELVENDAI
Download sequence
Identical sequences A0A165DIC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]