SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165RAT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165RAT2
Domain Number 1 Region: 243-251,302-413
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000942
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165RAT2
Sequence length 462
Comment (tr|A0A165RAT2|A0A165RAT2_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KZT23546.1} KW=Complete proteome; Reference proteome OX=1314782 OS=Neolentinus lepideus HHB14362 ss-1. GN=NEOLEDRAFT_536316 OC=Agaricomycetes; Gloeophyllales; Gloeophyllaceae; Neolentinus.
Sequence
MAMVQILNTESIRPPFFDDGQIDSSALDLVHKAYRRLQHAELVLFLKVRSLPATGTDDEL
ASRLAHYDINTYNIPGSYTGPKTSVNASKSCLSSAAVPPPESTPASSSFSSPPKSVRSRQ
QMLAPDLPVELIAEIMDRLGDWELSKAVGVPTSLPRPLSWTRACPTDEALLTGYLPVIRS
ADPSAHPPTKVGTSLAVRFGYVNVLAYFFLHHREVFLEVFCPHKMIPTIASNHGRIAILS
WLKHTMDNNPDMPRLSPKIIAECIDGASRHGQVASLDWWLHHSELAPDRVPHPLPFEYTD
YALEFASAKNHLAVLQWWKTHHLSPPQLPLKPGRSLDFASTAGNIDVLTWWASSSLEFKY
DKSAMYLASCHGKVDVLKWWLQSGLRLQYDGEVLVGATKHNRPEVLEWWDKSGLEVQYRM
CDVEEALEDAIGGGEQARDWWKRKGVDFNTTDKEWTQLRNLN
Download sequence
Identical sequences A0A165RAT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]