SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165XC09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165XC09
Domain Number 1 Region: 531-648
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000745
Family Pseudo ankyrin repeat 0.036
Further Details:      
 
Weak hits

Sequence:  A0A165XC09
Domain Number - Region: 142-290
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00215
Family Ankyrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165XC09
Sequence length 690
Comment (tr|A0A165XC09|A0A165XC09_MIMIV) Uncharacterized protein {ECO:0000313|EMBL:AMZ02672.1} OX=1835008 OS=Mimivirus Bombay. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MNLEGKTFYLLEENGTSEYPLYKIIDKTYILSNIKDIVAHIVKCDYDDDYTDDEAEDVSE
GVVEKTTITEIQLDFSNPKFVVNNFIPDENQAANGIYYTNSIIKIGEHDIYDENFLIELI
EESSQSKVFPENTCNLYRFGLNSGKFNLCDVLIQKGIEYKCTDHNYGRPLIVLYPDNGEI
EEIYLYLLKNMEHFKDDFVKIIQAVTEDSYEFDVLKSYIEYAQCTNIPINYLEISINIIK
IHHKTECIKLFIEMGLVNAQDIFYESCLHFSDLTGYLVDQGVEFNFSDVFSLDLPLDTLE
YFTEKGFEPTDEMIVNKLNDSNKSTPKINNDSSSFGTIMIMTPDYSFTRYKPPYYSILID
FLLNNKYLKSHHINQNVIDKLIEESSLIELVKLDKEFDIKSYIDLNILIKEAIDSDIWFV
VKHCIENGINIDDCMSYALDKSMMYIVKKLKKLGAIVPDNFIELDKINIDDQEHIQMCIN
KGMDITTIYNEIILNGSHKTLKYIANQMIQQGLKLPKITNSLIYFKYQKYIKCDKHIKVI
RNLNIDFTPIQQVVLAINDCDIETAKYLIGQYQIHDNLKILFMSVISQNIEFTKYLIEVN
NFDKTYTGWALVLSTYNYEMFRSVLDYTGIDVNTRQQEIILMVNPNDVNVDDTIDYLHLM
GYPNIFKTIDLISKDDKPIYKFLKKFNIEI
Download sequence
Identical sequences A0A0G2Y4W7 A0A0U2TSN3 A0A140E0J0 A0A165XC09 A0A1E1ESS7 E3VZ89 Q5UQC0
YL226_MIMIV gi|311977602|ref|YP_003986722.1| YP_003986722.1.55212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]