SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A166RZJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A166RZJ8
Domain Number 1 Region: 28-210
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.92e-27
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00034
Further Details:      
 
Domain Number 2 Region: 397-505
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000144
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A166RZJ8
Sequence length 599
Comment (tr|A0A166RZJ8|A0A166RZJ8_9PEZI) Phosphopantothenoylcysteine decarboxylase {ECO:0000313|EMBL:KZL70001.1} KW=Complete proteome; Reference proteome OX=1573173 OS=Colletotrichum incanum. GN=CI238_10045 OC=Colletotrichum.
Sequence
MDPPDPLPLRITRSASSSSSLHFKPRDRKLHLLVAANGPRDISWAQTLVVRLSKSSAIEM
RAIVDDAVPRLSQTVITMQNRSMTLPLGPSRAGSEADVDDIEFYRQQAFELVEWADLFVL
APIDADNMAKMMVGIADTFLLEVLRGWDTAKKILLVPGMSTHMWENPATKRQLNKINSKW
PWIRAMPPILWHYDSSHKNPKRIVNWNGFNDVLGIIKNQADLLGLGRDVDVVTHLGYLAS
GDPRVYSNLPPEIWTIILDYAGDWELAQALGIFTNLPMPHPWKLQPRDPNDPLKVYEHEL
EWLVLTCDSTSICKKLLQSPPTFHELPALVIKLLIRFSLTEVLAWMEANRPDLFQAFDGK
VLATKASAYFGRPDVLDYWKESRYFRGRHQQCYDAEALDGASKNGFIQVLDWWWRRSGLP
LRFTEAALEQASGKGHLLVLEWWRDAAAQDDTIVLRPGKSLLWAAQHGQVDVIRWWMASG
IPVAHGDGVAKIASRWGQVGVLELWRKLKGDDKLAFDGEVLVQPTIHQHIGVLEWWRKFA
YGELEGMEGRKHRVEYRTCDIEEALEDSIGDQEPVRRWWASNGLNLGLRNVEWMRPRYL
Download sequence
Identical sequences A0A166RZJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]