SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A166T8S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A166T8S5
Domain Number 1 Region: 17-228
Classification Level Classification E-value
Superfamily eIF4e-like 4.32e-51
Family Translation initiation factor eIF4e 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A166T8S5
Sequence length 253
Comment (tr|A0A166T8S5|A0A166T8S5_9PEZI) Translation initiation factor {ECO:0000313|EMBL:KZL71720.1} KW=Complete proteome; Reference proteome OX=708197 OS=Colletotrichum tofieldiae. GN=CT0861_12012 OC=Colletotrichum.
Sequence
MAARPALFTRGLSGLSQSTTDPNSPSVSSPADQRDDAKRNFLKAMRPLPTQHYWNVYFDK
QSKEQQKAGSDEEYKVQLEQLGSQIESVQDFWKYNNNTPVDQIKMRESIYLFKQGFKPIW
EDRRNINGGAWTFRVPKNIGPDVWTRVQLLAIGEKLQSVLDDNDQICGVGLSVRFNSHLI
SIWHRDGSKQKSIDAILECVLEELPAELRPKADNYFYKRHQDHAGFKAPPELQVVIDSQK
AADKAKAVGGAPA
Download sequence
Identical sequences A0A166T8S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]